PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0018600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family bHLH
Protein Properties Length: 94aa    MW: 10520.9 Da    PI: 10.2164
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0018600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH19.32e-0623591854
                    HHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
             HLH 18 safeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                    +  ++L+ llP+    ++ ++s + +L+ +++YI+sL
  Spipo4G0018600 23 ELVSKLQALLPETRTRGNDRVSASKVLQDTCNYIRSL 59
                    56689*******668999*****************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.3E-7580IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.083559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.15E-82080IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSRSRQ GSSTRITEDQ IIELVSKLQA LLPETRTRGN DRVSASKVLQ DTCNYIRSLH  60
REVDDLSERL SQMLATTEMS SAQAAIIRNL LTQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389574.15e-41PREDICTED: transcription factor ILI6-like
SwissprotB8APB51e-36ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR21e-36ILI6_ORYSJ; Transcription factor ILI6
TrEMBLM0S5Y26e-41M0S5Y2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P07410_0012e-40(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-33bHLH family protein